PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00016.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 279aa    MW: 31567.4 Da    PI: 6.3591
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00016.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.2e-142067148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEd +l ++    G g+W+ +a+  g+ R++k+c++rw +yl
  Rsa1.0_00016.1_g00001.1 20 KGLWSPEEDSKLMQYMISNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 67
                             678*******************************************97 PP

2Myb_DNA-binding48.91.5e-1573116146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg+++++E++l+++ +  lG++ W+ Ia++++ gRt++++k++w++
  Rsa1.0_00016.1_g00001.1  73 RGAFSPQEEDLIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 116
                              89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-221470IPR009057Homeodomain-like
PROSITE profilePS5129416.011567IPR017930Myb domain
SuperFamilySSF466891.25E-2718114IPR009057Homeodomain-like
SMARTSM007175.9E-111969IPR001005SANT/Myb domain
PfamPF002491.5E-132067IPR001005SANT/Myb domain
CDDcd001678.39E-92367No hitNo description
PROSITE profilePS5129424.44968122IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.5E-2571123IPR009057Homeodomain-like
SMARTSM007172.3E-1572120IPR001005SANT/Myb domain
PfamPF002491.7E-1473116IPR001005SANT/Myb domain
CDDcd001671.93E-1075115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MRKPEVAAIA ATHQAKKMKK GLWSPEEDSK LMQYMISNGQ GCWSDVAKNA GLQRCGKSCR  60
LRWINYLRPD LKRGAFSPQE EDLIIRFHSI LGNRWSQIAA RLPGRTDNEI KNFWNSTIKK  120
RLKKMSDTSN LVNNSSSSPN ASDSSSNSSS SLEFKDIIGS FMSLQEQGFI NPSLTNIPTN  180
NNTFPAPHMI SHLFNDDFTP YADGFCGVNT GLQGELYFPP LECEEGNWYK GEINNHLDEV  240
NTNGAGNVPE SMRMEECWDL DQLMNTEVPS FYFNFKQNI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28201227108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382830.0KF738283.1 Brassica napus MYB transcription factor 46 (MYB46.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013609611.11e-178PREDICTED: transcription factor MYB46
SwissprotQ9LXV21e-163MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D3EFY01e-178A0A0D3EFY0_BRAOL; Uncharacterized protein
STRINGBra008875.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61152347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-160myb domain protein 46